PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678454674
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SRS
Protein Properties Length: 344aa    MW: 36139.3 Da    PI: 7.1022
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678454674genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702200.64.7e-621132703154
     DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa........aeaaskrkrel.....kskkqsalsst 89 
                +g++sCqdCGnqakkdC+h+RCRtCCksrgf+C+thvkstWvpaakrrerqqq++ +s  + +++               +r        +  +  l   
  678454674 113 NGGISCQDCGNQAKKDCTHMRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQQQSETSGGKRQREtptvsnslV-----CTRIPtpsgnLNLDSHMLPLL 207
                6789**********************************************999887765555544344332221.....122222222233334444455 PP

     DUF702  90 klssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                +l++++  + le+ ++P++v ++avfrcvrvs+vd+  +++aYq+av+i GhvfkGiLydqG+e+
  678454674 208 QLEETSCVEGLEAGNFPSQVTAPAVFRCVRVSAVDE--DQFAYQAAVNIRGHVFKGILYDQGTEA 270
                666666777777777*******************96..79**********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.6E-59115269IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.4E-27117159IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.1E-23223267IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MAGFFTLGGA AAAAADPPIS SEIHPENWFL LRNEESVVPV SVPVPYRGFE LWQHQQQQRG  60
QGQEENNSLQ EMYGSGGGLG VGPSRGGGGL GDGSRPGFLM MRSAGAAAAA PGNGGISCQD  120
CGNQAKKDCT HMRCRTCCKS RGFQCQTHVK STWVPAAKRR ERQQQQSETS GGKRQRETPT  180
VSNSLVCTRI PTPSGNLNLD SHMLPLLQLE ETSCVEGLEA GNFPSQVTAP AVFRCVRVSA  240
VDEDQFAYQA AVNIRGHVFK GILYDQGTEA QYLAAVAAGD TSSGGGSISA GGHPLNLITG  300
TSTSGTPTAV VTGGPALPLL DTSFYPAPIN SFMAGTQFFP QSRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100954.11e-107PREDICTED: protein SHORT INTERNODES
TrEMBLA0A061DFV61e-100A0A061DFV6_THECC; Lateral root primordium protein-related, putative
STRINGSolyc02g084680.2.12e-91(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA67824110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.17e-60Lateral root primordium (LRP) protein-related